DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and Y87G2A.18

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001021834.1 Gene:Y87G2A.18 / 3564964 WormBaseID:WBGene00013604 Length:118 Species:Caenorhabditis elegans


Alignment Length:107 Identity:28/107 - (26%)
Similarity:48/107 - (44%) Gaps:14/107 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ETTGPAPVPASTS--TTQHTVVVVPGSPYGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILC 107
            |...|.|.|.:.|  .|..|      |||...|:::.||:|.|:..:.:.........:|..||.
 Worm    17 EQNAPEPNPQNDSRYITSRT------SPYNVMPIEMDCPHCQNHIVSHIERVAGVLPWIIFAILA 75

  Fly   108 LFQLY------CCVCLPYCISSCMNTNHYCGMCDRYLGTYDR 143
            ...::      |..|:|:.:...::.||.|..|.::||.::|
 Worm    76 FLGIFLFIIPWCFCCVPFFLDQLLDVNHSCPACKKFLGRFNR 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 18/67 (27%)
zf-LITAF-like 74..142 CDD:287559 17/73 (23%)
Y87G2A.18NP_001021834.1 LITAF 43..117 CDD:197841 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.