DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and CG12645

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001096935.1 Gene:CG12645 / 31947 FlyBaseID:FBgn0030181 Length:206 Species:Drosophila melanogaster


Alignment Length:167 Identity:48/167 - (28%)
Similarity:65/167 - (38%) Gaps:53/167 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LLPPAPPSY-----------------DQATTTPAETTG--------PAPVPASTSTTQHTV---- 63
            |.|..||:|                 |:..|..||...        |.|:|.|.:..:.:|    
  Fly    27 LSPSEPPTYYDAMQTFTIQNNLDYSNDRRRTLFAEPQHLRSRVEEMPMPMPMSQTKDEVSVQSEG 91

  Fly    64 -----------------------VVVPGSPYGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALI 105
                                   ::.|....|.:.||:.||.|.....||:...||:||:|.||.
  Fly    92 LADNNSIDHRAMPPVRSKCDDFFILSPQPKLGSQAMDIVCPACGQRGVTRLKRSPNARTNLWALC 156

  Fly   106 LCLFQLYCCVCL-PYCISSCMNTNHYCGMCDRYLGTY 141
            ||.|...||.|| ||..:.|..|||||..|:.:||.:
  Fly   157 LCTFGWCCCACLFPYLWNGCRTTNHYCSACEIFLGAH 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 30/128 (23%)
zf-LITAF-like 74..142 CDD:287559 32/69 (46%)
CG12645NP_001096935.1 zf-LITAF-like 129..193 CDD:287559 30/63 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448958
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DZV6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.