DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and CG32280

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster


Alignment Length:128 Identity:45/128 - (35%)
Similarity:60/128 - (46%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ATPEQQHLLPP-APPSYDQAT--TTPAETTGPAPVPASTSTTQHTVVVVPGSPYGPEPMDVQCPY 82
            |.|:..::.|| |||||.:|.  ..|.....|...||:|:.|.....|||.|......:   ||.
  Fly     7 APPQFTYVPPPSAPPSYQEAVGGVKPVGPYTPVVAPATTANTTIVTTVVPISRTSTHMI---CPS 68

  Fly    83 CHNYARTRVSFKPNSRTHLIALILCLF--QLYCCVCLPYCISSCMNTNHYCGMCDRYLGTYDR 143
            ||....|....:|....:|...::.||  .|.||: :|.||..||:.:|.|..|..|||.|.|
  Fly    69 CHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCL-IPCCIDDCMDVHHSCPNCRAYLGRYRR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 23/80 (29%)
zf-LITAF-like 74..142 CDD:287559 23/69 (33%)
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 23/72 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
54.910

Return to query results.
Submit another query.