DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and CG30273

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_726223.1 Gene:CG30273 / 246520 FlyBaseID:FBgn0050273 Length:128 Species:Drosophila melanogaster


Alignment Length:138 Identity:56/138 - (40%)
Similarity:77/138 - (55%) Gaps:22/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EAPKGSVELQATPEQQHLLPPAPPSYDQATTTPA------ETTGPAPVPASTSTTQHTVVVVPGS 69
            :.|.|:      |...|.:|  ||||:|.....|      .||.|.||    ...||..|:    
  Fly     5 QQPAGA------PGYPHQMP--PPSYEQVVHVQAPVRVVHHTTAPPPV----VIIQHQAVL---- 53

  Fly    70 PYGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCISSCMNTNHYCGMC 134
            |.||:|..:.||:||....|||.:.|:.:||.:|.|||:..|:||.|||||.:||||.||:||.|
  Fly    54 PVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCACLPYCATSCMNANHFCGNC 118

  Fly   135 DRYLGTYD 142
            ::::|.|:
  Fly   119 NKFVGVYN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 31/82 (38%)
zf-LITAF-like 74..142 CDD:287559 33/67 (49%)
CG30273NP_726223.1 zf-LITAF-like 59..126 CDD:287559 33/66 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5124
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - otm14624
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
87.890

Return to query results.
Submit another query.