DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and Y37D8A.6

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_499672.1 Gene:Y37D8A.6 / 189614 WormBaseID:WBGene00012548 Length:132 Species:Caenorhabditis elegans


Alignment Length:130 Identity:36/130 - (27%)
Similarity:51/130 - (39%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PPAPPSYDQA-----------TTTPAETTGPAPVPASTSTTQHTVVVVPGSPYGP--EPMDVQCP 81
            |.|||:|.:|           |..|.:..|..||..   ..|...:::.|:...|  ||....||
 Worm    11 PQAPPAYAEAQQPPPTIIYPPTQMPQQGPGQGPVYV---VQQPQEIIIVGTKMAPSFEPYTEFCP 72

  Fly    82 YCHNYARTRVSFKPN--SRTHLIALILCLFQLYCCVCLPYCISSCMNTNHYCGMCDRYLGTYDRK 144
            .|:....|||.....  |.|.|...:...|.|.||    :|:....::.|.|..|...| :|.|:
 Worm    73 RCNTNVCTRVERTMGFCSWTMLFLGLFVFFPLLCC----FCLDGFKDSRHSCPNCGTIL-SYKRR 132

  Fly   145  144
             Worm   133  132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 23/91 (25%)
zf-LITAF-like 74..142 CDD:287559 20/69 (29%)
Y37D8A.6NP_499672.1 LITAF 66..132 CDD:197841 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.900

Return to query results.
Submit another query.