DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and B0348.1

DIOPT Version :10

Sequence 1:NP_611704.2 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_503128.1 Gene:B0348.1 / 181935 WormBaseID:WBGene00015151 Length:87 Species:Caenorhabditis elegans


Alignment Length:83 Identity:26/83 - (31%)
Similarity:34/83 - (40%) Gaps:8/83 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VVVPGSPYGP------EPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCIS 122
            :.||.:.|||      ||....||.|.....||:..: ......||..:..| |:..:|...|..
 Worm     1 MAVPITVYGPKMTEHYEPYSEYCPKCQCNHTTRMESR-RGNCWWIAFFIGFF-LFFPICYWLCCQ 63

  Fly   123 SCMNTNHYCGMCDRYLGT 140
            |..:|.|||..|...|.|
 Worm    64 SSKDTLHYCPSCGTLLAT 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_611704.2 PTZ00144 <6..>63 CDD:240289
zf-LITAF-like 73..142 CDD:463165 22/74 (30%)
B0348.1NP_503128.1 LITAF 18..82 CDD:197841 20/66 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.