powered by:
Protein Alignment CG30269 and LITAFD
DIOPT Version :9
Sequence 1: | NP_001303360.1 |
Gene: | CG30269 / 37600 |
FlyBaseID: | FBgn0050269 |
Length: | 144 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011521084.1 |
Gene: | LITAFD / 101929989 |
HGNCID: | 53927 |
Length: | 121 |
Species: | Homo sapiens |
Alignment Length: | 71 |
Identity: | 29/71 - (40%) |
Similarity: | 36/71 - (50%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 PMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLF--QLYCCVCLPYCISSCMNTNHYCGMCDRY 137
|:...||||.|...|..:|.|.:.|.|:...|.|| .|.||. |.:||.|.|:..|.|.:|.|.
Human 51 PVQAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCF-LAFCIRSLMDVKHSCPVCQRE 114
Fly 138 LGTYDR 143
|..|.|
Human 115 LFYYHR 120
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000358 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100529 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23292 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X238 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.910 |
|
Return to query results.
Submit another query.