DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30269 and LITAFD

DIOPT Version :9

Sequence 1:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_011521084.1 Gene:LITAFD / 101929989 HGNCID:53927 Length:121 Species:Homo sapiens


Alignment Length:71 Identity:29/71 - (40%)
Similarity:36/71 - (50%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLF--QLYCCVCLPYCISSCMNTNHYCGMCDRY 137
            |:...||||.|...|..:|.|.:.|.|:...|.||  .|.||. |.:||.|.|:..|.|.:|.|.
Human    51 PVQAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCF-LAFCIRSLMDVKHSCPVCQRE 114

  Fly   138 LGTYDR 143
            |..|.|
Human   115 LFYYHR 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 14/37 (38%)
zf-LITAF-like 74..142 CDD:287559 27/68 (40%)
LITAFDXP_011521084.1 zf-LITAF-like 51..119 CDD:371158 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.