DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNJ3 and Irk3

DIOPT Version :9

Sequence 1:NP_002230.1 Gene:KCNJ3 / 3760 HGNCID:6264 Length:501 Species:Homo sapiens
Sequence 2:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster


Alignment Length:383 Identity:114/383 - (29%)
Similarity:198/383 - (51%) Gaps:47/383 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    17 TSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWR 81
            |...|||  |:....|..     ::...|.::|||:.||....:..::.||:.||.|||::|:|:
  Fly    96 TPDLGSG--PRTSSSDGL-----RRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWK 153

Human    82 WNLFIFILTYTVAWLFMASMWWVIAYTRGDL------NKAHVGNYTPCVANVYNFPSAFLFFIET 140
            :.|.:|:.:|.::||..|::.:|:||:.||.      .|.......||:..|:::.:..::.:||
  Fly   154 YMLTLFLGSYFLSWLLFAALCYVVAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVET 218

Human   141 EATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMR 205
            :.|:|:|.:|.:::|||.|.||:.|.:..::::..::..::.|.::|.::...|.||:.|||..|
  Fly   219 QTTLGFGEKYASEECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYR 283

Human   206 DGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTI 270
            ||:|.|:|||.:.|....:.::||..::..::|.|||.:. ..:||.:   .|..:..::.|..:
  Fly   284 DGRLCLLFRVCDPREQQSIESKIRVYIIVDKRTREGETIK-SHVELKL---EGNGEQIILWPDVV 344

Human   271 CHVIDAKSPFYDLSQ----RSMQTEQFEIVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVI 331
            |||||..||   |||    :.....|||:.|.:.|....|....:|:|||...|:.||.||..:|
  Fly   345 CHVIDETSP---LSQFTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNII 406

Human   332 --SLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVE 387
              ..:...:.|||..|:.|..|..|                     :||.|..|..:|
  Fly   407 HYDAQNERYIVDYENFNRTISVDMP---------------------MTNPKNDHLKLE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNJ3NP_002230.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 6/22 (27%)
IRK 47..187 CDD:395797 43/145 (30%)
Selectivity filter. /evidence=ECO:0000250 143..148 2/4 (50%)
IRK_C 194..364 CDD:407551 58/175 (33%)
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 102/340 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.