DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and LITAF

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_011521056.1 Gene:LITAF / 9516 HGNCID:16841 Length:191 Species:Homo sapiens


Alignment Length:146 Identity:44/146 - (30%)
Similarity:60/146 - (41%) Gaps:28/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 APGFQAPPSYDSA-------PQQVYPQLHQGQGVIL----QGENTENYES----IGNNAP----- 58
            ||  .|||||:..       |....|......|::.    :|.|..:|.:    |.||.|     
Human    46 AP--SAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQT 108

  Fly    59 -----PNVLGQCPSVATCPSCGVRRETKVEFEPSTKTHLLALLICMLGGIC-CCCIPYCTDSCQS 117
                 |......|....||||.....:::.:.....|.|....:|:||.|. ||.||:|.|:.|.
Human   109 VYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQD 173

  Fly   118 AKHTCTSCGAYVGTYK 133
            ..|.|.:|.|.:||||
Human   174 VDHYCPNCRALLGTYK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 24/67 (36%)
LITAFXP_011521056.1 zf-LITAF-like 121..189 CDD:287559 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4048
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.