powered by:
Protein Alignment CG4250 and CG42566
DIOPT Version :9
Sequence 1: | NP_001246468.1 |
Gene: | CG4250 / 37599 |
FlyBaseID: | FBgn0034761 |
Length: | 134 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097421.2 |
Gene: | CG42566 / 8674120 |
FlyBaseID: | FBgn0260768 |
Length: | 77 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 31/72 - (43%) |
Similarity: | 46/72 - (63%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 LGQCPSVATCPSCGVRRETKVEFEPSTKTHLLALLICMLGGICCCCIPYCTDSCQSAKHTCTSCG 126
:|..|.:..||||..:..|:||.:.:|||||:||::|:.....|.|..|||...:::.|.|.||.
Fly 5 VGPEPCIVVCPSCRQQVTTRVEPKATTKTHLIALIMCLTFLWPCACCLYCTQCARNSDHHCPSCN 69
Fly 127 AYVGTYK 133
||:|||:
Fly 70 AYIGTYE 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
53 |
1.000 |
Inparanoid score |
I4084 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D136484at33392 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000358 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm14624 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR23292 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X238 |
|
6 | 6.160 |
|
Return to query results.
Submit another query.