DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and CG42566

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001097421.2 Gene:CG42566 / 8674120 FlyBaseID:FBgn0260768 Length:77 Species:Drosophila melanogaster


Alignment Length:72 Identity:31/72 - (43%)
Similarity:46/72 - (63%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGQCPSVATCPSCGVRRETKVEFEPSTKTHLLALLICMLGGICCCCIPYCTDSCQSAKHTCTSCG 126
            :|..|.:..||||..:..|:||.:.:|||||:||::|:.....|.|..|||...:::.|.|.||.
  Fly     5 VGPEPCIVVCPSCRQQVTTRVEPKATTKTHLIALIMCLTFLWPCACCLYCTQCARNSDHHCPSCN 69

  Fly   127 AYVGTYK 133
            ||:|||:
  Fly    70 AYIGTYE 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 29/66 (44%)
CG42566NP_001097421.2 zf-LITAF-like 8..76 CDD:287559 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136484at33392
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - otm14624
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
66.160

Return to query results.
Submit another query.