DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and si:dkeyp-75b4.8

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_001336328.1 Gene:si:dkeyp-75b4.8 / 796031 ZFINID:ZDB-GENE-090313-395 Length:182 Species:Danio rerio


Alignment Length:155 Identity:41/155 - (26%)
Similarity:65/155 - (41%) Gaps:29/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YENMQPQAPGFQA----PPSYD--SAPQQV-----------YPQLHQGQGV--ILQGENTENYES 52
            |:.:.|..|..:.    ||:|:  :.||.:           ||.|:|...:  :.|.:.....:|
Zfish    25 YDEIIPPPPTIKTPATPPPAYNEPNIPQGIPLNTCTGGPNPYPILNQPTQIAAVTQQQQVFVQQS 89

  Fly    53 IGNNAP---------PNVLGQCPSVATCPSCGVRRETKVEFEPSTKTHLLALLICMLGGIC-CCC 107
            :...||         ...|...|:...|..|.....|.||::|...:.|:.::|..||||| ||.
Zfish    90 VNPVAPQVIVVQPQQSTTLDDTPASIVCRYCHQSIVTHVEYKPGVISWLMCVVISFLGGICGCCV 154

  Fly   108 IPYCTDSCQSAKHTCTSCGAYVGTY 132
            ||:.......|.|:|..|..::|.|
Zfish   155 IPFFVRGFLDAHHSCPLCKRHIGIY 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 24/68 (35%)
si:dkeyp-75b4.8XP_001336328.1 zf-LITAF-like 111..179 CDD:287559 23/67 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.