DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and cdip1

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001025631.1 Gene:cdip1 / 595019 XenbaseID:XB-GENE-5752851 Length:207 Species:Xenopus tropicalis


Alignment Length:185 Identity:38/185 - (20%)
Similarity:53/185 - (28%) Gaps:73/185 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YENMQPQAPGFQAPPSYDSAP-----------------------------QQVYPQLH-----QG 37
            |....|.||....||.||:.|                             |..||..:     ||
 Frog    35 YPQAMPFAPPDCGPPPYDANPGYIAPNPGFYPPPGPYAPMGYYPPTPGQFQPPYPSQYPSPGAQG 99

  Fly    38 QGVI-----------------------LQGENTENYESIGNNAPPNVLGQCPSVATCPSCGVRRE 79
            ..||                       ||||               :....|....|.:|.....
 Frog   100 TAVIVPPGPSSTSAATTVTSTTTTVTVLQGE---------------IFQGSPVQTVCTNCQQPIT 149

  Fly    80 TKVEFEPSTKTHLLALLICMLG-GICCCCIPYCTDSCQSAKHTCTSCGAYVGTYK 133
            ||:..:......||....|.:| .:.||.||...:..:...|:|.:|..::.||:
 Frog   150 TKISHDIGLMNFLLCCFCCFVGCDLGCCLIPCIINDLKDVTHSCPNCKYHIYTYR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 17/67 (25%)
cdip1NP_001025631.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 8/18 (44%)
zf-LITAF-like 135..204 CDD:402300 17/68 (25%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 161..183 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.