DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and si:ch211-202h22.9

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001139042.1 Gene:si:ch211-202h22.9 / 559480 ZFINID:ZDB-GENE-030131-1143 Length:140 Species:Danio rerio


Alignment Length:163 Identity:45/163 - (27%)
Similarity:58/163 - (35%) Gaps:56/163 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKNFQ---YENMQ--------------------PQAPGFQAP---PSYDSAPQQVYPQLHQGQG 39
            |||:::   |.:.|                    |||..:|.|   |.|.|.|..:..|      
Zfish     1 MEKDYRPPPYSSPQMDQTQINYPVQPAPYPPPAGPQAAPYQPPPYGPPYTSQPMPIPVQ------ 59

  Fly    40 VILQGENTENYESIGNNAPPNVLGQCPSVATCPSCGVRRETKVEFEPSTKTHL----LALLICML 100
                            ..|...|...|...|||.|.....|:.|........|    |||.:|.|
Zfish    60 ----------------QMPLTSLTDVPGRITCPHCLTEVITETEHVSGLMAWLICGTLALFVCWL 108

  Fly   101 GGICCCCIPYCTDSCQSAKHTCTSCGAYVGTYK 133
                |||||:|.|:|:..||||.:|...:..||
Zfish   109 ----CCCIPFCLDACKDVKHTCPNCRNIIRIYK 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 26/70 (37%)
si:ch211-202h22.9NP_001139042.1 zf-LITAF-like 70..137 CDD:287559 26/70 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578948
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4048
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.