DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and cdip1

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001092712.1 Gene:cdip1 / 557073 ZFINID:ZDB-GENE-070720-18 Length:213 Species:Danio rerio


Alignment Length:176 Identity:41/176 - (23%)
Similarity:53/176 - (30%) Gaps:77/176 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QAPGFQAP--PSYDSAPQQV-------------YPQL---------HQGQG-------------- 39
            |.|||..|  |.....|:.:             ||.|         :.|.|              
Zfish    57 QQPGFVPPHVPGEGPIPKPMHMPMPMPHPHGGYYPPLGHFPHTMGEYAGPGPSHFAPGHTATVLA 121

  Fly    40 ---------VILQGENTENYESIGNNAPPNVLGQCPSVATCPSCGVRRETKVEFEPSTKTHLLAL 95
                     .:||||               :....|....||.|.....|::    |....|:..
Zfish   122 PPGAATTTVTVLQGE---------------MFQSAPVQTVCPHCQQPIITRI----SHDIGLMNT 167

  Fly    96 LICM--------LGGICCCCIPYCTDSCQSAKHTCTSCGAYVGTYK 133
            |:||        ||   ||.||...|..:...|||.:|..|:.|||
Zfish   168 LVCMFCFFVGCDLG---CCLIPCLIDDLKDVTHTCPNCKGYIYTYK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 23/74 (31%)
cdip1NP_001092712.1 zf-LITAF-like 142..210 CDD:287559 23/74 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.