DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and Litafd

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_579752.3 Gene:Litafd / 497862 RGDID:1564086 Length:209 Species:Rattus norvegicus


Alignment Length:131 Identity:36/131 - (27%)
Similarity:47/131 - (35%) Gaps:22/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKNFQYENMQPQAPGFQAPPSY--DSAPQ-QVYPQLHQGQGVILQGENTENYESIGNNAPPNVLG 63
            :|..|..:.|.:.   :.||.|  ...|: :|||........:..|..|..         |.|..
  Rat    80 QKENQNHDFQQRR---ELPPPYYPPRGPRSRVYPMYTHVPPTVQAGLFTSR---------PRVAT 132

  Fly    64 QCPSVATCPSCGVRRETKVEFEPSTKTHLL--ALLI--CMLGGICCCCIPYCTDSCQSAKHTCTS 124
            ..|....||.||....|.....|...|.||  .|.:  |.||   ||.:|:|..|.....|:|..
  Rat   133 SMPVQIICPYCGNFITTVANPIPGLLTWLLCSGLFVFGCFLG---CCLLPFCMQSLMDVVHSCPM 194

  Fly   125 C 125
            |
  Rat   195 C 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 22/64 (34%)
LitafdXP_579752.3 zf-LITAF-like 135..203 CDD:287559 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.