DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and CG13559

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster


Alignment Length:129 Identity:31/129 - (24%)
Similarity:42/129 - (32%) Gaps:43/129 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PQAPGFQAPPSYDSAPQQVYPQLHQGQGVILQGENTENYESIGNNAPPNVLGQCPSVATCPSCGV 76
            |..|    ||||:.|......:.|....::  .|||.                  |:..||.|  
  Fly     8 PSTP----PPSYEEAMGWETRRSHSTTWLL--AENTS------------------SLMICPMC-- 46

  Fly    77 RRETKVEFEPSTK----------THLLALLICMLGGICCCCIPYCTDSCQSAKHTCTSCGAYVG 130
                ..|.|.:||          :.::....|   ||.|..||...|......|:|..|.|.:|
  Fly    47 ----HDEIETTTKIRRRWIAYVASGIVLFTTC---GIGCWLIPCILDCFNEIHHSCPVCKATLG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 20/75 (27%)
CG13559NP_611801.1 LITAF 38..107 CDD:197841 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D155863at50557
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.