DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and CG30269

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster


Alignment Length:114 Identity:41/114 - (35%)
Similarity:58/114 - (50%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 APPSYDSAPQQVYPQLHQGQGVILQGENTENYESIGNNAPPNVLGQCPSVATCPSCGVRRETKVE 83
            ||||||.|  ...|....|...:....:|..:..:  ..|.:..|..|....||.|.....|:|.
  Fly    32 APPSYDQA--TTTPAETTGPAPVPASTSTTQHTVV--VVPGSPYGPEPMDVQCPYCHNYARTRVS 92

  Fly    84 FEPSTKTHLLALLICMLGGICCCCIPYCTDSCQSAKHTCTSCGAYVGTY 132
            |:|:::|||:||::|:....||.|:|||..||.:..|.|..|..|:|||
  Fly    93 FKPNSRTHLIALILCLFQLYCCVCLPYCISSCMNTNHYCGMCDRYLGTY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 29/67 (43%)
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 24/80 (30%)
zf-LITAF-like 74..142 CDD:287559 29/68 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DZV6
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - otm14624
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
98.790

Return to query results.
Submit another query.