DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and CG42565

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001286738.1 Gene:CG42565 / 37598 FlyBaseID:FBgn0260767 Length:135 Species:Drosophila melanogaster


Alignment Length:132 Identity:33/132 - (25%)
Similarity:56/132 - (42%) Gaps:26/132 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PGFQAPPSYD---------SAPQQVYPQLHQGQGVILQGENTENYES---IGNNAPPNVLGQCPS 67
            |...|||:.|         :.|..|.|.:.|...| ||..:..::::   :.|.....:      
  Fly    16 PFATAPPAEDVMQQNLASPAHPNPVIPVMAQTMPV-LQPVSVMHHQTTVLVDNTRQGTI------ 73

  Fly    68 VATCPSCGVRRETKVEFEPSTKTHLLALLICMLGGIC--CCCIPYCTDSCQSAKHTCTSCGAYVG 130
               ||.|..|...:||..|:..|:.:|.|:|:.  :|  |.|.|.|.:.|......|.:|.:.:|
  Fly    74 ---CPHCNARIRLRVEHHPTGSTYCMAALLCLF--LCWPCVCAPCCCNCCYKTSQYCPNCNSCLG 133

  Fly   131 TY 132
            ::
  Fly   134 SF 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 20/69 (29%)
CG42565NP_001286738.1 zf-LITAF-like 72..135 CDD:287559 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
44.010

Return to query results.
Submit another query.