DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and CG13510

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001246465.1 Gene:CG13510 / 37596 FlyBaseID:FBgn0034758 Length:129 Species:Drosophila melanogaster


Alignment Length:129 Identity:51/129 - (39%)
Similarity:65/129 - (50%) Gaps:20/129 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ENMQPQAPGFQAPPSYDSAPQQVYPQLHQGQGVILQGENTENYESIGNNAPPNVLGQCPSVATCP 72
            :..||..|  ..||.|...||.     .|...||:|...|.|...||:.         |:...||
  Fly    19 QTYQPGGP--TQPPLYPPMPQP-----PQSSTVIIQTTTTSNLVPIGSG---------PTRIRCP 67

  Fly    73 SCGVRRETKVEFEPSTKTHLLALLICMLGGIC--CCCIPYCTDSCQSAKHTCTSCGAYVGTYKN 134
            ||.....|.|:..||.:||..||::|:.  ||  |.|:|||.||||:|.|.|.:|.||:|||:|
  Fly    68 SCHAEVLTTVKSTPSGRTHCWALILCLF--ICWPCVCLPYCMDSCQNANHYCPNCSAYIGTYEN 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 33/68 (49%)
CG13510NP_001246465.1 zf-LITAF-like 61..128 CDD:287559 33/68 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448947
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DZV6
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136484at33392
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - otm14624
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4048
SonicParanoid 1 1.000 - - X238
1110.830

Return to query results.
Submit another query.