DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and Y87G2A.19

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001021835.1 Gene:Y87G2A.19 / 3565150 WormBaseID:WBGene00044260 Length:110 Species:Caenorhabditis elegans


Alignment Length:76 Identity:23/76 - (30%)
Similarity:40/76 - (52%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGQCPSVATCPSCGVRRETKVEFEPSTKTHLLALLICMLG----GICCCCIPYCTDSCQSAKHTC 122
            |...|.:..||.|.|..||::.|.....|::...:|.:.|    .:....:|:|.::.:.|:|.|
 Worm    29 LSDRPQLLDCPRCKVHGETELRFVNGFFTYVSFFIILIFGFAILPLFFLWVPFCVETFKDAEHYC 93

  Fly   123 TSCGAYVGTYK 133
            .||.|::|||:
 Worm    94 PSCRAWIGTYR 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 21/70 (30%)
Y87G2A.19NP_001021835.1 LITAF 33..105 CDD:197841 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.