DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and CG32280

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster


Alignment Length:138 Identity:42/138 - (30%)
Similarity:52/138 - (37%) Gaps:31/138 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PGFQAPPSYDSAPQQVYPQLHQGQGVILQGENTENYESIGNNAP---PNVLGQCPSVAT------ 70
            || .|||.:...|....|..:|        |.....:.:|...|   |........|.|      
  Fly     4 PG-SAPPQFTYVPPPSAPPSYQ--------EAVGGVKPVGPYTPVVAPATTANTTIVTTVVPISR 59

  Fly    71 ------CPSCGVRRETKVEFEPSTKTH----LLALLICMLGGICCCCIPYCTDSCQSAKHTCTSC 125
                  ||||....||....||....:    |:||..|.||   ||.||.|.|.|....|:|.:|
  Fly    60 TSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLG---CCLIPCCIDDCMDVHHSCPNC 121

  Fly   126 GAYVGTYK 133
            .||:|.|:
  Fly   122 RAYLGRYR 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 29/82 (35%)
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 27/71 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D155863at50557
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
65.920

Return to query results.
Submit another query.