DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and Y22D7AL.15

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_497438.2 Gene:Y22D7AL.15 / 189508 WormBaseID:WBGene00021253 Length:152 Species:Caenorhabditis elegans


Alignment Length:155 Identity:40/155 - (25%)
Similarity:58/155 - (37%) Gaps:33/155 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NFQYENMQPQAPGFQ---APPSY---DSAPQQV--------YPQLH-QGQGVILQG---ENTENY 50
            |.:...:.|.|.|.|   |||.|   ..||..|        |||.. .||..::|.   :.....
 Worm     3 NPETAQVYPVATGPQMDSAPPPYTVVGGAPVAVEMQPVYAAYPQQQAYGQPTVVQAHVVQQPTQA 67

  Fly    51 ESIGNNAPPNVLGQCPSVATCPSCGVRRETKVEFEPSTKT-HLLALL--ICMLGGICCCCIP--- 109
            ..|.:.:..:|....|.:..||.|    :|.|    :|:| |.:...  |.:..|:...|.|   
 Worm    68 TVIISASVKHVDQDKPYLEYCPRC----QTSV----TTRTVHSIGTCWWIILFIGVFVFCWPILY 124

  Fly   110 -YCTDSCQSAKHTCTSCGAYVGTYK 133
             .|....:..||.|.:||..:...|
 Worm   125 CLCCAGSKDVKHFCPNCGTMLACKK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 19/73 (26%)
Y22D7AL.15NP_497438.2 PRK10263 <7..>89 CDD:236669 20/81 (25%)
LITAF 83..150 CDD:197841 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.