powered by:
Protein Alignment CG4250 and B0348.2
DIOPT Version :9
Sequence 1: | NP_001246468.1 |
Gene: | CG4250 / 37599 |
FlyBaseID: | FBgn0034761 |
Length: | 134 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_503127.2 |
Gene: | B0348.2 / 181936 |
WormBaseID: | WBGene00015152 |
Length: | 86 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 20/72 - (27%) |
Similarity: | 31/72 - (43%) |
Gaps: | 8/72 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 VLG----QC--PSVATCPSCGVRRETKVEFEPSTKTHLLALLICMLGGICCCCIPYCTDSCQSAK 119
||| :| |....|..|...:.|:.|.:......::.::.|:|....|..: |.||.:...
Worm 7 VLGPTLTECTEPHQVFCQKCQCNQVTRTETQLGACWWVVFIIGCLLFWPICYWL--CCDSSKDTM 69
Fly 120 HTCTSCG 126
|.|.|||
Worm 70 HYCPSCG 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1564782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23292 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.020 |
|
Return to query results.
Submit another query.