DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and LOC100498592

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_002939494.2 Gene:LOC100498592 / 100498592 -ID:- Length:193 Species:Xenopus tropicalis


Alignment Length:157 Identity:34/157 - (21%)
Similarity:55/157 - (35%) Gaps:44/157 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKNFQYE----NMQPQAPGFQAPPSYDSAPQQVYPQLHQGQGVI-----------------LQG 44
            :|.|..|.    |..|..||...|......|    ..:|....::                 :||
 Frog    54 IEFNLPYSVNMPNALPIPPGNFLPEINQPNP----ANMHNALAIVPMRNLMPVPMAPCSVSPVQG 114

  Fly    45 ENTENYESIGNNAPPNVLGQCPSVATCPSCGVRRETKVEFEPSTKTHLLALLICMLGGIC---CC 106
            .|  |:.            :.|:..||..|..:..|:.|:...:.|.:|.|:|.:.|  |   ||
 Frog   115 AN--NFR------------EAPTFTTCSFCQSQVRTRTEYTIGSLTVILFLIIILFG--CWFGCC 163

  Fly   107 CIPYCTDSCQSAKHTCTSCGAYVGTYK 133
            .||:....|:...|.|.:|...:..::
 Frog   164 LIPFFVQHCKDVNHFCPNCNRLIHRFR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 20/69 (29%)
LOC100498592XP_002939494.2 zf-LITAF-like 122..190 CDD:371158 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.