DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4250 and litafd

DIOPT Version :9

Sequence 1:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_002939491.1 Gene:litafd / 100498168 XenbaseID:XB-GENE-22164436 Length:141 Species:Xenopus tropicalis


Alignment Length:141 Identity:42/141 - (29%)
Similarity:56/141 - (39%) Gaps:36/141 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PQAPGF----QAPPSYDSAPQQVYPQLHQGQGVILQGENTENYESIGN---NAPP--------NV 61
            || |||    ..||:|:.:...|||.             ...|.||..   ..||        :.
 Frog    16 PQ-PGFGGAYPPPPAYNPSSGAVYPP-------------PPVYNSIPGQPVTVPPVVTPIIVTST 66

  Fly    62 LGQCPSVATCPSCGVRRETKVEFEPSTKTHLLALLI----CMLGGICCCCIPYCTDSCQSAKHTC 122
            ....|:..|||||.....|.:.:.....|.||..::    |.||   ||.||:|.|||:...|.|
 Frog    67 FQDTPASTTCPSCRQNIITNIHYNIGLLTWLLFGILFIFGCWLG---CCLIPFCVDSCKDVDHYC 128

  Fly   123 TSCGAYVGTYK 133
            .:|..::..||
 Frog   129 PNCNHHLYKYK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:287559 24/70 (34%)
litafdXP_002939491.1 zf-LITAF-like 70..139 CDD:371158 24/71 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.