DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42565 and Litafd

DIOPT Version :10

Sequence 1:NP_611702.1 Gene:CG42565 / 37598 FlyBaseID:FBgn0260767 Length:135 Species:Drosophila melanogaster
Sequence 2:XP_038942976.2 Gene:Litafd / 497862 RGDID:1564086 Length:108 Species:Rattus norvegicus


Alignment Length:77 Identity:20/77 - (25%)
Similarity:29/77 - (37%) Gaps:8/77 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PVSVMHHQTTVLVDNTRQGTICPHCNARIRLRVEHHPTGSTYCMAALLCLFLCW-PCVCAPCCCN 116
            |.:.|.||.:..:       |||:|...|.......|...|:.:.:.|.:|.|: .|...|.|..
  Rat    25 PCTPMSHQQSKQI-------ICPYCGNFITTVANPIPGLLTWLLCSGLFVFGCFLGCCLLPFCMQ 82

  Fly   117 CCYKTSQYCPNC 128
            ........||.|
  Rat    83 SLMDVVHSCPMC 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42565NP_611702.1 zf-LITAF-like 68..135 CDD:463165 16/62 (26%)
LitafdXP_038942976.2 None

Return to query results.
Submit another query.