DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42565 and CG32280

DIOPT Version :9

Sequence 1:NP_001286738.1 Gene:CG42565 / 37598 FlyBaseID:FBgn0260767 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster


Alignment Length:127 Identity:38/127 - (29%)
Similarity:50/127 - (39%) Gaps:14/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PPPYSDPFATAPPAEDVMQQNLASPAHPNPVIPVMAQTMPVLQPVSVMHHQTTVLVDNTRQGTIC 74
            |||      :|||:   .|:.:.......|..||:|........:..    |.|.:..|....||
  Fly    15 PPP------SAPPS---YQEAVGGVKPVGPYTPVVAPATTANTTIVT----TVVPISRTSTHMIC 66

  Fly    75 PHCNARIRLRVEHHPTGSTYCMAALLCLFLCW-PCVCAPCCCNCCYKTSQYCPNCNSCLGSF 135
            |.|:|.|.......|....|....|:.||.|| .|...|||.:.|......||||.:.||.:
  Fly    67 PSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRY 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42565NP_001286738.1 zf-LITAF-like 72..135 CDD:287559 24/63 (38%)
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 25/69 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
44.010

Return to query results.
Submit another query.