DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13511 and cdip1

DIOPT Version :10

Sequence 1:NP_611701.1 Gene:CG13511 / 37597 FlyBaseID:FBgn0034759 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001025631.1 Gene:cdip1 / 595019 XenbaseID:XB-GENE-5752851 Length:207 Species:Xenopus tropicalis


Alignment Length:121 Identity:33/121 - (27%)
Similarity:47/121 - (38%) Gaps:33/121 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PEPADTEMVTVTTQPNYGVVVTQIPVYTLNGVGPGAHPLAVGCKPMRVRCPSCRGEVTTSLATSP 74
            |.|:.|...|..|.....|.|.|..::  .|            .|::..|.:|:..:||.:    
 Frog   106 PGPSSTSAATTVTSTTTTVTVLQGEIF--QG------------SPVQTVCTNCQQPITTKI---- 152

  Fly    75 TRKTHMCALTLYICCCWPFIC----------LPYFINYCKSVQHYCPNCGCHIGSY 120
               :|...|..::.||  |.|          :|..||..|.|.|.||||..||.:|
 Frog   153 ---SHDIGLMNFLLCC--FCCFVGCDLGCCLIPCIINDLKDVTHSCPNCKYHIYTY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13511NP_611701.1 zf-LITAF-like 53..120 CDD:463165 23/76 (30%)
cdip1NP_001025631.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
zf-LITAF-like 135..204 CDD:463165 24/78 (31%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 161..183 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.