DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13511 and Cdip1

DIOPT Version :10

Sequence 1:NP_611701.1 Gene:CG13511 / 37597 FlyBaseID:FBgn0034759 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001008361.1 Gene:Cdip1 / 360480 RGDID:1310686 Length:208 Species:Rattus norvegicus


Alignment Length:101 Identity:28/101 - (27%)
Similarity:39/101 - (38%) Gaps:25/101 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GPGAHPLAV----GC--------------KPMRVRCPSCRGEVTTSLATSPTRKTHMCALTLYIC 88
            |||.|...|    |.              .|::..||.|:..:||.::........:..   :.|
  Rat   107 GPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLG---FFC 168

  Fly    89 C---CWPFICL-PYFINYCKSVQHYCPNCGCHIGSY 120
            |   |....|| |..||..|.|.|.||:|..:|.:|
  Rat   169 CFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYICTY 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13511NP_611701.1 zf-LITAF-like 53..120 CDD:463165 21/70 (30%)
Cdip1NP_001008361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
zf-LITAF-like 137..205 CDD:463165 22/71 (31%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 164..184 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.