DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13511 and Y87G2A.19

DIOPT Version :10

Sequence 1:NP_611701.1 Gene:CG13511 / 37597 FlyBaseID:FBgn0034759 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001021835.1 Gene:Y87G2A.19 / 3565150 WormBaseID:WBGene00044260 Length:110 Species:Caenorhabditis elegans


Alignment Length:75 Identity:22/75 - (29%)
Similarity:35/75 - (46%) Gaps:10/75 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KPMRVRCPSCRGEVTTSLATSPTRKTHMCALTLYICCCWPFICLPYF---INYC----KSVQHYC 110
            :|..:.||.|:....|.|.......|:   ::.:|...:.|..||.|   :.:|    |..:|||
 Worm    32 RPQLLDCPRCKVHGETELRFVNGFFTY---VSFFIILIFGFAILPLFFLWVPFCVETFKDAEHYC 93

  Fly   111 PNCGCHIGSY 120
            |:|...||:|
 Worm    94 PSCRAWIGTY 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13511NP_611701.1 zf-LITAF-like 53..120 CDD:463165 21/73 (29%)
Y87G2A.19NP_001021835.1 LITAF 33..105 CDD:197841 22/74 (30%)

Return to query results.
Submit another query.