DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13511 and CG12645

DIOPT Version :10

Sequence 1:NP_611701.1 Gene:CG13511 / 37597 FlyBaseID:FBgn0034759 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001096935.1 Gene:CG12645 / 31947 FlyBaseID:FBgn0030181 Length:206 Species:Drosophila melanogaster


Alignment Length:75 Identity:26/75 - (34%)
Similarity:38/75 - (50%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VGCKPMRVRCPSCRGEVTTSLATSPTRKTH---MCALTLYICCCWPFICL-PYFINYCKSVQHYC 110
            :|.:.|.:.||:|.....|.|..||..:|:   :|..|...|||   .|| ||..|.|::..|||
  Fly   122 LGSQAMDIVCPACGQRGVTRLKRSPNARTNLWALCLCTFGWCCC---ACLFPYLWNGCRTTNHYC 183

  Fly   111 PNCGCHIGSY 120
            ..|...:|::
  Fly   184 SACEIFLGAH 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13511NP_611701.1 zf-LITAF-like 53..120 CDD:463165 25/70 (36%)
CG12645NP_001096935.1 zf-LITAF-like 129..193 CDD:463165 24/66 (36%)

Return to query results.
Submit another query.