DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13510 and litaf

DIOPT Version :10

Sequence 1:NP_611700.2 Gene:CG13510 / 37596 FlyBaseID:FBgn0034758 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001002184.1 Gene:litaf / 431731 ZFINID:ZDB-GENE-040704-23 Length:163 Species:Danio rerio


Alignment Length:144 Identity:47/144 - (32%)
Similarity:68/144 - (47%) Gaps:25/144 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PPPYSEQSG---YTPAQTYQP-----GGPTQPP--------LYPP--MPQPPQSSTVIIQTTTTS 52
            ||.|.|.||   |.||..|.|     .||  ||        :|||  ..||..|..|.:||....
Zfish    22 PPSYDEISGANPYYPAGPYPPADMKASGP--PPYPTQEYNQMYPPTAQGQPVTSPVVAVQTVYVQ 84

  Fly    53 NLVPIGSGPTRIRCPSCHAEVLTTVK--STPSGRTHCWALILCLFIC-WPCVCLPYCMDSCQNAN 114
            ..:..|:.|.:..||.|...|:|.::  |.|.....|..  |.:|.| :.|..:|:|::..::..
Zfish    85 PGLVFGNVPVQAHCPVCSQSVITRLEYSSGPLVWLSCAG--LAVFGCIYGCCLIPFCIEDLKDVT 147

  Fly   115 HYCPNCSAYIGTYE 128
            |:|||||:.:|.::
Zfish   148 HHCPNCSSVLGVHK 161

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG13510NP_611700.2 zf-LITAF-like 61..128 CDD:463165 22/69 (32%)