DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30196 and Cdip1

DIOPT Version :10

Sequence 1:NP_726220.1 Gene:CG30196 / 37595 FlyBaseID:FBgn0050196 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001345008.1 Gene:Cdip1 / 66626 MGIID:1913876 Length:229 Species:Mus musculus


Alignment Length:98 Identity:31/98 - (31%)
Similarity:35/98 - (35%) Gaps:24/98 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LDGSAFEGDISSIPQVGHLTTEPQELECPACQQLQTTHVKSEAVT---VLQKIACSLNV-LLCC- 66
            |.|..|||             .|.:..||.|||..||.:..|...   ||....|.:.. |.|| 
Mouse   149 LQGEIFEG-------------APVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCL 200

  Fly    67 NPIRWKGRHDVNHYCSSCGCFIGRDITLSWYKR 99
            .|.......||.|.|.||..:|      ..|||
Mouse   201 IPCLINDFKDVTHTCPSCKAYI------CTYKR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30196NP_726220.1 LITAF 29..90 CDD:197841 23/65 (35%)
Cdip1NP_001345008.1 zf-LITAF-like 158..226 CDD:463165 23/73 (32%)

Return to query results.
Submit another query.