DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30196 and si:ch211-157c3.4

DIOPT Version :10

Sequence 1:NP_726220.1 Gene:CG30196 / 37595 FlyBaseID:FBgn0050196 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001157840.1 Gene:si:ch211-157c3.4 / 561592 ZFINID:ZDB-GENE-030131-8454 Length:149 Species:Danio rerio


Alignment Length:66 Identity:22/66 - (33%)
Similarity:27/66 - (40%) Gaps:7/66 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LTTEPQELECPACQQLQTTHVKSEAVTVLQKIACSL-----NVLLCC-NPIRWKGRHDVNHYCSS 83
            |..:|....|.:|||...|:| :..|.|...:.|.|     .||.|| .|...|...|..|.|..
Zfish    72 LGRKPAMATCTSCQQQVLTNV-TYKVGVYAWLMCILIFFCGFVLGCCLIPFFMKFFKDAYHSCPR 135

  Fly    84 C 84
            |
Zfish   136 C 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30196NP_726220.1 LITAF 29..90 CDD:197841 21/62 (34%)
si:ch211-157c3.4NP_001157840.1 zf-LITAF-like 74..142 CDD:463165 21/64 (33%)

Return to query results.
Submit another query.