DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d2 and CYP72C1

DIOPT Version :9

Sequence 1:NP_611698.1 Gene:Cyp6d2 / 37594 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:275 Identity:59/275 - (21%)
Similarity:101/275 - (36%) Gaps:66/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGVDEEPAKIPFGVMDTVMKQERSLGMALADIYARHEGKIVGIYMLNKRSILIRDAQLARQIMTS 92
            |..|..|..:|| :..||:|                .||....:.....::::.|.:..|:||  
plant    75 LDADFLPRMMPF-LHHTVLK----------------HGKKCFTWYGPYPNVIVMDPETLREIM-- 120

  Fly    93 DFASFHDRGVY----VDEDKDPLSANLFNLRGASWRNLRQKLTPSFSSGKIKGMFGTIDDVGDKL 153
               |.|:  ::    :........:.|.|..|..|...|..|.|:|....:|.:....:....::
plant   121 ---SKHE--LFPKPKIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEM 180

  Fly   154 VQHLEGALDQSDEVEIKDVMTTYAVDIIGSVI----FGLEIDSFRNPKNEFREISSSTSRDESL- 213
            ::..|........:|:..  .|:..|:..:::    ||   ||:::....| ||     :.|.: 
plant   181 LEEWERLASAKGTMELDS--WTHCHDLTRNMLARASFG---DSYKDGIKIF-EI-----QQEQID 234

  Fly   214 --LLKIHNM----SMFICPPIAKLMNRLGYESRILTSLRDMMKRTIEFREEHNVVRKDMLQLLIR 272
              ||.|..:    |.|:  | .|...||....|   .:|.|.|..||.:||.          :.|
plant   235 LGLLAIRAVYIPGSKFL--P-TKFNRRLRETER---DMRAMFKAMIETKEEE----------IKR 283

  Fly   273 LRNTGKIGEDDDQVW 287
            .|.|.|..:...:.|
plant   284 GRGTDKNSDCCSRCW 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 51/238 (21%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.