DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d2 and CYP72A11

DIOPT Version :9

Sequence 1:NP_611698.1 Gene:Cyp6d2 / 37594 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_188083.1 Gene:CYP72A11 / 820693 AraportID:AT3G14650 Length:512 Species:Arabidopsis thaliana


Alignment Length:431 Identity:105/431 - (24%)
Similarity:168/431 - (38%) Gaps:71/431 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SILIRDAQLARQIMTS--DFASFHDRGVYVDEDKDPL----SANLFNLRGASWRNLRQKLTPSFS 135
            :|.|.|.:...:::..  ||...|         ..||    :..:.:..|..|...|:.:.|:|.
plant   105 TITIMDPEQITEVLNKVYDFQKAH---------TFPLGRLIATGVLSYDGDKWAKHRRIINPAFH 160

  Fly   136 SGKIKGMF-------GTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVIFGLEIDSF 193
            ..|||.|.       ..|....||||...|    .|.||::...:.:...|:|....||      
plant   161 LEKIKNMVPAFHQSCSEIVCKWDKLVSDKE----SSCEVDVWPGLVSMTADVISRTAFG------ 215

  Fly   194 RNPKNEFREISSSTSRDESLLLKIHNMSMFICPPIAKLMNRLGYESRILTSLRDMMKRTIEFREE 258
                       ||....:.:......::..|...:.|.... ||........|.|..:..|.:  
plant   216 -----------SSCVEGQRIFELQAELAQLIIQTVRKAFIP-GYSYLPTKGNRRMKAKAREIQ-- 266

  Fly   259 HNVVRKDMLQLLIRLRNTGKIGEDD--DQVWDMETAQEQLKSMSIEKIAAQAFLFYVAGSESTAA 321
              |:.:.::...:|.|..|:...||  ..:.:....|.:...||.|.:..:..|||..|.|:|:.
plant   267 --VILRGIVNKRLRAREAGEAPNDDLLGILLESNLGQTKGNGMSTEDLMEECKLFYFVGQETTSV 329

  Fly   322 ASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDICIMETIRKYPGLPF 386
            ...:|:..||.:.:....|:|||..|.   ..|..|.   |.:..||.:.:.:.|.:|.||.:|.
plant   330 LLVWTMVLLSQHQDWQARAREEVKQVF---GDKEPDA---EGLNQLKVMTMILYEVLRLYPPIPQ 388

  Fly   387 LNRECTE-----DYPVPGTNHIIAKGTPILISLFGMQRDPVYFPNPNG-YDPHRFDS--NNMNYD 443
            |:|...:     |..:||.   :....|||:    :|||...:.|..| :.|.||..  :....:
plant   389 LSRAIHKEMELGDLTLPGG---VLINLPILL----VQRDTELWGNDAGEFKPDRFKDGLSKATKN 446

  Fly   444 QAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSP 484
            ||::.||..|.|.||......:.:|:|:|.||..|....||
plant   447 QASFFPFAWGSRICIGQNFALLEAKMAMALILQRFSFELSP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 105/431 (24%)
CYP72A11NP_188083.1 p450 24..512 CDD:299894 105/431 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.