DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d2 and CYP72A10

DIOPT Version :9

Sequence 1:NP_611698.1 Gene:Cyp6d2 / 37594 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_188082.2 Gene:CYP72A10 / 820692 AraportID:AT3G14640 Length:536 Species:Arabidopsis thaliana


Alignment Length:435 Identity:111/435 - (25%)
Similarity:178/435 - (40%) Gaps:73/435 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDP-------LSANLFNLRGASWRNLRQKLTP 132
            |.:|.|.|.:|.:::...         || |..|..       ::..:.|..|..|...|:.:.|
plant   125 KPTITIMDPELIKEVFNK---------VY-DYPKAQTFLLGRLIATGIINYDGDKWAKHRRIINP 179

  Fly   133 SFSSGKIKGMFGTI-----DDVGD--KLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVIFGLEI 190
            :|...|||.|....     |.||:  |||.. :|:  .|.||::...:.:...|:|....||   
plant   180 AFHIEKIKNMVPAFHQSCSDVVGEWSKLVSD-KGS--SSCEVDVWPWLVSMTGDVISRTAFG--- 238

  Fly   191 DSFRNPKNEFREISSSTSRDESLLLKIHNMSMFICPPIAKLMNRLGYESRILTSLRDMMKRTIEF 255
            .|::..:..| |:.:     |.:.|.:........|         ||......|.|.|.....|.
plant   239 SSYKEGQRIF-ELQA-----ELVHLILQAFWKVYIP---------GYRYLPTKSNRRMKAAAREI 288

  Fly   256 REEHNVVRKDMLQLLIRLRNTGKIGEDDDQ---VWDMETAQEQLKSMSIEKIAAQAFLFYVAGSE 317
            :    |:.|.::...:|.|..||...:||.   :.:....|.:...||.|.:..:..|||.||.|
plant   289 Q----VILKGIVNKRLRAREAGKAAPNDDLLGILLESNLGQAKGNGMSTEDVMEECKLFYFAGQE 349

  Fly   318 STAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDICIMETIRKYP 382
            :|:....:.:..||.:.:....|:|||     |.....|:..| |.:..||.:.:.:.|.:|.||
plant   350 TTSVLLVWAMVLLSHHQDWQARAREEV-----KQVFGDKEPDT-ECLSQLKVMTMILYEVLRLYP 408

  Fly   383 GLPFLNRECTE-----DYPVPGTNHIIAKGTPILISLFGMQRDPVYF-PNPNGYDPHRFDS--NN 439
            .:..|.|...:     |..:|...||   ..||::    :||||:.: .:...:.|.||..  :.
plant   409 PVTHLTRAIDKEMKLGDLTLPAGVHI---SLPIML----VQRDPMLWGTDAAEFKPERFKDGLSK 466

  Fly   440 MNYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSP 484
            ....|.::.||..|||.||......:.:|:|:|.||..|....||
plant   467 ATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQTFTFELSP 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 111/435 (26%)
CYP72A10NP_188082.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.