DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30195 and si:ch211-157c3.4

DIOPT Version :10

Sequence 1:NP_611696.2 Gene:CG30195 / 37592 FlyBaseID:FBgn0050195 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001157840.1 Gene:si:ch211-157c3.4 / 561592 ZFINID:ZDB-GENE-030131-8454 Length:149 Species:Danio rerio


Alignment Length:67 Identity:17/67 - (25%)
Similarity:25/67 - (37%) Gaps:14/67 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKEEPTWIRCPSCEKSGTSLVQLE------LVTCLQRFLGFTKLC------KKWSGRQDINHYCS 74
            |..:|....|.||::...:.|..:      |:..|..|.||...|      .|:.  :|..|.|.
Zfish    72 LGRKPAMATCTSCQQQVLTNVTYKVGVYAWLMCILIFFCGFVLGCCLIPFFMKFF--KDAYHSCP 134

  Fly    75 HC 76
            .|
Zfish   135 RC 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30195NP_611696.2 zf-LITAF-like 26..85 CDD:470665 16/63 (25%)
si:ch211-157c3.4NP_001157840.1 zf-LITAF-like 74..142 CDD:463165 16/65 (25%)

Return to query results.
Submit another query.