DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30195 and CG12645

DIOPT Version :10

Sequence 1:NP_611696.2 Gene:CG30195 / 37592 FlyBaseID:FBgn0050195 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001096935.1 Gene:CG12645 / 31947 FlyBaseID:FBgn0030181 Length:206 Species:Drosophila melanogaster


Alignment Length:102 Identity:32/102 - (31%)
Similarity:44/102 - (43%) Gaps:29/102 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IVSHKPQVGYLKEEPTWIRCPSCEKSG-----------TSLVQLELVT-------CLQRFLGFTK 58
            |:|.:|::|   .:...|.||:|.:.|           |:|..|.|.|       ||..:|    
  Fly   115 ILSPQPKLG---SQAMDIVCPACGQRGVTRLKRSPNARTNLWALCLCTFGWCCCACLFPYL---- 172

  Fly    59 LCKKWSGRQDINHYCSHCGCFIGRFVPISCMERCISR 95
                |:|.:..|||||.|..|:|...|.||...|..|
  Fly   173 ----WNGCRTTNHYCSACEIFLGAHYPRSCCCCCCRR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30195NP_611696.2 zf-LITAF-like 26..85 CDD:470665 23/76 (30%)
CG12645NP_001096935.1 zf-LITAF-like 129..193 CDD:463165 23/71 (32%)

Return to query results.
Submit another query.