DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and CPR8

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:58/218 - (26%)
Similarity:89/218 - (40%) Gaps:42/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLSVFVVALVAGVVVA-----DDSKG--------------PKVTEKVFFDITI----GGEPA 42
            ||.|.....||.:...:.|     |:.:.              |.:|..|...|..    ..|.|
Yeast     1 MKSFFLYLYVAFMFSCITALPLPVDNKRASSDSLDLKKKYAPDPPITHNVNIGIVFTDPESSEEA 65

  Fly    43 GR-IEIGLFGKTVPKTVENF--------KELALKPQGEGYKGSK-FHRIIKDFMIQGGDFTKGDG 97
            || |.|.|:|..|||||..|        ..||.:   ..|...: |.:|:.:..|:|.. .....
Yeast    66 GRLITIDLYGTMVPKTVMTFCQYVDSVKDRLASR---HSYSPERDFDKILPNGAIEGSS-VSSSS 126

  Fly    98 TGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGM- 161
            .....:...:..:||..|.|...|.:||.   ||..|.:|.|.|.:|. |:|..||||::.:|: 
Yeast   127 IEETEMLAPKLPEENHSLIHDRPGRVSMI---KDDKGLKFIIETSETP-LEGESVVFGQVTAGLK 187

  Fly   162 NVVRQIENSATDARDRPVKDVVI 184
            :::.::.|..||...:|.:.:.|
Yeast   188 DLMDKLANVKTDENGKPEQPITI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 49/170 (29%)
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 45/152 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.