DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and CPR3

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_013633.1 Gene:CPR3 / 854897 SGDID:S000004543 Length:182 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:91/165 - (55%)
Similarity:113/165 - (68%) Gaps:1/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGG 90
            ::.:|||||..:.|...||||..|:...||||.|||:.|....:|.||||..|||||.|||||||
Yeast    19 RLGKKVFFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMIQGG 83

  Fly    91 DFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFG 155
            |....:|.||:||||.:|.||||..||..||.|||||||.:||||||||||....||||:|||||
Yeast    84 DTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFG 148

  Fly   156 KILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            ::..||::|:.||:..| |..:|..::||..:|.|
Yeast   149 EVTKGMDIVKAIESYGT-ASGKPRAEIVIEEAGEL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 89/157 (57%)
CPR3NP_013633.1 cyclophilin_ABH_like 23..180 CDD:238907 89/157 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.