DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and AT1G01940

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_171696.2 Gene:AT1G01940 / 839309 AraportID:AT1G01940 Length:160 Species:Arabidopsis thaliana


Alignment Length:141 Identity:69/141 - (48%)
Similarity:90/141 - (63%) Gaps:5/141 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGER 107
            |.|:..:|...|||:.|||  |||...|. |.|:.|||.||.||||||| .||.|.||.||:|::
plant    10 GDIKCEIFCDEVPKSAENF--LALCASGY-YDGTIFHRNIKGFMIQGGD-PKGTGKGGTSIWGKK 70

  Fly   108 FEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSA 171
            |.|| ...|||...|.|||||:|.:|||||||||..:...|:|.:.:|||::.|..|:..:|.:.
plant    71 FNDEIRDSLKHNARGMLSMANSGPNTNGSQFFITYAKQPHLNGLYTIFGKVIHGFEVLDIMEKTQ 135

  Fly   172 TDARDRPVKDV 182
            |...|||:.::
plant   136 TGPGDRPLAEI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 69/141 (49%)
AT1G01940NP_171696.2 Cyclophilin_PPIL3_like 1..153 CDD:238909 69/141 (49%)

Return to query results.
Submit another query.