DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and ATE1

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_563931.2 Gene:ATE1 / 837930 AraportID:AT1G13690 Length:177 Species:Arabidopsis thaliana


Alignment Length:31 Identity:10/31 - (32%)
Similarity:13/31 - (41%) Gaps:5/31 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DGTGGRSIYGERFEDENF----KLKHYGAGW 122
            |...|..:|| |....|:    |:|....||
plant    72 DNMDGAELYG-RVLTVNYALPEKIKGGEQGW 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 10/31 (32%)
ATE1NP_563931.2 RRM_PPIE 15..89 CDD:409783 6/17 (35%)

Return to query results.
Submit another query.