DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and PUB49

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_201554.1 Gene:PUB49 / 836889 AraportID:AT5G67530 Length:595 Species:Arabidopsis thaliana


Alignment Length:175 Identity:73/175 - (41%)
Similarity:99/175 - (56%) Gaps:12/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMI 87
            |.||....|.|..|     .|.:.|.|.....|:..|||  :.|..:|. |.|..|||.|::|||
plant   338 KNPKKKGYVQFQTT-----HGDLNIELHCDIAPRACENF--ITLCERGY-YNGVAFHRSIRNFMI 394

  Fly    88 QGGDFTKGDGTGGRSIYGERFEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRH 151
            ||||.| |.|.||.||:|:.|:|| |.||.|.|.|.:||||:|..|||||||:..|..:.|:.:|
plant   395 QGGDPT-GTGKGGESIWGKPFKDEPNSKLLHSGRGVVSMANSGPHTNGSQFFVLYKSATHLNYKH 458

  Fly   152 VVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL--PVSE 194
            .|||.::.|:..:..:||...|..|||::::.|..:...  |.:|
plant   459 TVFGGVVGGLATLAAMENVPVDESDRPLEEIKIIEASVFVNPYTE 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 68/158 (43%)
PUB49NP_201554.1 RING-Ubox_PPIL2 38..110 CDD:438325
RING_Ubox 101..159 CDD:473075
cyclophilin_RING 345..502 CDD:238904 69/165 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.