DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Ppig

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_113981.2 Gene:Ppig / 83624 RGDID:620315 Length:752 Species:Rattus norvegicus


Alignment Length:176 Identity:96/176 - (54%)
Similarity:116/176 - (65%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GPKVTE-KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG--------YKGSKFH 79
            |.||.. :.||||.|..:||||:...||....|||.|||:.|....:|.|        ||...||
  Rat     2 GIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFH 66

  Fly    80 RIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQT 144
            |::||||:|||||::|:|.||.||||..||||:|.:||.....|||||.||||||||||||||.|
  Rat    67 RVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPT 131

  Fly   145 SWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190
            ..|||.|||||:::||..|||:|||..|||..:|..:|.|.:.|.|
  Rat   132 PHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 91/165 (55%)
PpigNP_113981.2 cyclophilin 8..175 CDD:412213 91/166 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.