DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and Pnsl5

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_196816.1 Gene:Pnsl5 / 831151 AraportID:AT5G13120 Length:259 Species:Arabidopsis thaliana


Alignment Length:191 Identity:119/191 - (62%)
Similarity:142/191 - (74%) Gaps:6/191 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVALVAGVVVADDSKGPKVTEKVFFDITIG---GEPAGRIEIGLFGKTVPKTVENFKELALKPQ 69
            |.|...|.||....|   |:|.||:|||::|   |:.||||.|||:|..||:|||||:.|....:
plant    72 FSVQSNAEVVTEPQS---KITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEK 133

  Fly    70 GEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNG 134
            |.|||||.|||:|:|||||||||.||:||||:|:||..|:||||||.|.|.|.|||||||.:|||
plant   134 GFGYKGSTFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNG 198

  Fly   135 SQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEA 195
            |||||.|.:||||||||||||:::.||.||:.||...||..|||.|.||||:.|.||:|||
plant   199 SQFFICTIKTSWLDGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPMSEA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 105/160 (66%)
Pnsl5NP_196816.1 cyclophilin_ABH_like 90..252 CDD:238907 105/161 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H726
Inparanoid 1 1.050 231 1.000 Inparanoid score I1138
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - otm2954
orthoMCL 1 0.900 - - OOG6_100844
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X987
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.