DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and AT4G34960

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_195222.1 Gene:AT4G34960 / 829648 AraportID:AT4G34960 Length:224 Species:Arabidopsis thaliana


Alignment Length:202 Identity:98/202 - (48%)
Similarity:126/202 - (62%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVVALVAGVVVA------DDSK----GPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENF 61
            :.:|||...:|.|      |:.|    ..::|.:||.|:.|.|:..|||.|||:|..||||||||
plant    15 LLLVALTIFLVFALFNTGKDEEKQVIEDHEITNRVFLDVDIDGQRLGRIVIGLYGTVVPKTVENF 79

  Fly    62 KELALKPQGE-------GYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYG 119
            :.|....:|:       .|||:.|||||..|:|||||...|||....||||..|.|||||::|..
plant    80 RALCTGEKGKTSSGKPLHYKGTPFHRIISGFVIQGGDIIHGDGKSSDSIYGGTFPDENFKIQHSH 144

  Fly   120 AGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVI 184
            ||.::|||.|.|:|||||||||.:.|||:|.|||.||::.||:.|..||..|.....:|.|.|||
plant   145 AGMVAMANTGPDSNGSQFFITTVKASWLEGEHVVLGKVIQGMDNVFAIEGGAGTYSGKPRKKVVI 209

  Fly   185 ANSGTLP 191
            |:||.:|
plant   210 ADSGEIP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 87/164 (53%)
AT4G34960NP_195222.1 cyclophilin 48..213 CDD:412213 87/164 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.