DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and AT4G33060

DIOPT Version :10

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_195032.2 Gene:AT4G33060 / 829443 AraportID:AT4G33060 Length:504 Species:Arabidopsis thaliana


Alignment Length:160 Identity:67/160 - (41%)
Similarity:92/160 - (57%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGY-KGSKFHRIIKDFMIQ 88
            |....||..:.|     .|.|::.|:.|..||:|.||.:|.|    ||| ..:.|||:|..|::|
plant     9 PPTKGKVIVNTT-----HGPIDVELWPKEAPKSVRNFVQLCL----EGYFDNTIFHRVIPGFLVQ 64

  Fly    89 GGDFTKGDGTGGRSIYGERFEDE-NFKLKHYGAGWLSMANAGK-DTNGSQFFITTKQTSWLDGRH 151
            |||.| |.||||.||||..|.|| :.:|:....|.::||||.. ::||||||.|..:..|||.:|
plant    65 GGDPT-GSGTGGDSIYGGVFADEFHSRLRFSHRGIVAMANASSPNSNGSQFFFTLDKCDWLDKKH 128

  Fly   152 VVFGKIL--SGMNVVRQIENSATDARDRPV 179
            .:|||:.  |..|::| :....|...|||:
plant   129 TIFGKVTGDSIYNLLR-LGEVDTSKDDRPL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 66/155 (43%)
AT4G33060NP_195032.2 cyclophilin_CeCYP16-like 8..180 CDD:238906 67/160 (42%)
PTZ00121 <248..>497 CDD:173412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.