DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and AT4G32420

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001190889.1 Gene:AT4G32420 / 829377 AraportID:AT4G32420 Length:837 Species:Arabidopsis thaliana


Alignment Length:171 Identity:70/171 - (40%)
Similarity:94/171 - (54%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG--------YKGSKFHRII 82
            |...:||.|::|.|:||..:...||.:..|||.|||:.|....:|.|        ||||.||||:
plant     4 KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSFFHRIM 68

  Fly    83 KDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWL 147
            |....|.|||...:||.|.|||..:|.||:.||:|...|.|||:.|.:|..||.|.||.:....|
plant    69 KGSSAQAGDFVNRNGTAGESIYAGKFPDESPKLRHEETGLLSMSIADRDKFGSHFHITFRPNQQL 133

  Fly   148 DGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSG 188
            |..:|||||::.|..::::||. ..|...:|...|.|...|
plant   134 DRNNVVFGKLIQGKEILKKIER-VGDEEGKPTVSVKIIRCG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 68/165 (41%)
AT4G32420NP_001190889.1 cyclophilin 7..173 CDD:381853 68/166 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.