DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2852 and AT3G55920

DIOPT Version :9

Sequence 1:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_567029.1 Gene:AT3G55920 / 824758 AraportID:AT3G55920 Length:228 Species:Arabidopsis thaliana


Alignment Length:178 Identity:112/178 - (62%)
Similarity:129/178 - (72%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG-------YKG 75
            |.:|.:|  ||.||:|||.|.|.|||||.|||||..||||.|||:.|....:|.|       :||
plant    50 VGEDLEG--VTHKVYFDIQINGSPAGRILIGLFGNIVPKTAENFRSLCTGEKGVGNMGKPLYFKG 112

  Fly    76 SKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFIT 140
            |.|||||..|||||||||:|||.||.||||::|.||||||||.|.|:|||||:|.|:||||||||
plant   113 SSFHRIIPGFMIQGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGFLSMANSGPDSNGSQFFIT 177

  Fly   141 TKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSG 188
            |..||||||.||||||:||||.|||:||....|: ..|..:|:|..||
plant   178 TVTTSWLDGHHVVFGKVLSGMEVVRKIEAQGQDS-GVPKANVIIFASG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 105/164 (64%)
AT3G55920NP_567029.1 cyclophilin_ABH_like 59..224 CDD:238907 105/165 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.